PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A01258.1.p
Common NameEUGRSUZ_A01258
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 419aa    MW: 45305.2 Da    PI: 9.5708
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A01258.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.85.1e-38160218462
            zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         lkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+n+k+s
  Eucgr.A01258.1.p 160 GPLKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNNKRS 218
                       5789**************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-32146214IPR003851Zinc finger, Dof-type
PfamPF027018.7E-32161216IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.376162216IPR003851Zinc finger, Dof-type
PROSITE patternPS013610164200IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MDWSSSARVL GGGTKAMGLV LMDLEIGIRG SSLTSMDLSL AHIKVPSFNF LPLIEFSPFC  60
NSLFVDVILH YSLKKPPLRP LLKRKSILTQ AMDFPSLPPY LDPSNWQQQQ TDHHQTGSSS  120
TNTQLLPPPP QPNGGGGASS IRPRLMADEA RLANITMPEG PLKCPRCEST NTKFCYFNNY  180
SLSQPRHFCK TCRRYWTRGG ALRNVPVGGG CRRNNKRSKS GSSKSVASSS HRQITAPRSG  240
STCIPTSNGG ANVDTTEILG VGTQLPPLGH FMAPMNYLPD NLTLSAGAGL NYNTGVPSPL  300
GDLNFLAATT CDGGALERWR LEQAQQLSSS GRLDPNLGLY PSEGRFESFR ALNVRPNAPP  360
SSAGLTAQLS SSVKMEDNNQ PFSRQFYGIN HENHPFLSSA SAWMDLSGFS SSSTRNPL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A01258.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010047599.10.0PREDICTED: dof zinc finger protein DOF2.4-like isoform X1
TrEMBLA0A059DDX90.0A0A059DDX9_EUCGR; Uncharacterized protein
STRINGVIT_08s0007g00180.t012e-77(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17132886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.14e-46DNA binding with one finger 2.4